Qüestionari tema 1 (Nota: 10) (2015)

Ejercicio Catalán
Universidad Universidad Rovira y Virgili (URV)
Grado Biotecnología - 2º curso
Asignatura Bioinformática
Año del apunte 2015
Páginas 3
Fecha de subida 28/04/2016
Descargas 19
Subido por

Vista previa del texto

Preguntes Tema 1 (únicament hi ha copiades les respostes correctes) 1. Quina de les següents definions es pot aplicar al terme bioinformàtica? o A set of software tools for molecular sequence analysis o Bioinformatics is the application of computer technology to the management and analysis of biological data.
o The use of computers to collect, analyze, and interpret biological information at the molecular level.
o An exciting new research field that involves the integration of computers, software tools, and databases in an effort to address biological questions.
2. En quin dels següents processos es pot aplicar la bioinformàtica? o Tractament de dades de microarrays o Comparació de seqüències o Seqüènciació i anotació de genomes o Cerca de similituds 3. Quina de les bases de dades següents trobem en el portal Expasy? o UniProtKB 4. Quin significat tenen les sigles NCBI? o National Center for Biotechnology Information 5. En quina ciutat es troba l'EBI? o Cambridge, UK 6. Aparella les següents bases de dades amb el centre/portal que les manté o PROSITE  Expasy o Protein Data Bank in Europe  EBI o Genbank  NCBI 7. Com és el creixement de la base de dades GenBank? o és un creixement exponencial 8. Què diu la Llei de Moore? o que aproximadament cada dos anys es duplica el nombre de transistors en una computadora 9. Aparella: o Base de dades que conté seqüències d'àcids nucleics  GenBank o Base de dades que conté informació sobre els enzims  Enzyme o Base de dades que conté seqüències de proteïnes  Swiss-Prot 10. Quina és la traducció en la primera pauta de lectura de la seqüència de DNA següent? Nota: Llegeix l'apartat "Cerca de pautes obertes de lectura (ORFs)".
ATGTTTAAAGGGCCCTGCGCTAGTCAAGACGAGCCATAG o MFKGPCASQDEP* 11. Tradueix la següent cadena de DNA en la primera pauta de lectura, utilitzant el codi genètic mitocondrial dels vertebrats.
5'- ATGAAACGTGCCTTTTGAGACATAGAATTCTGAAAAAGA 3' o MKRAFWDMEFWK* 12. En quina pauta de lectura creus que el següent fragment de DNA codifica per a una proteïna? Nota: Llegeix l'apartat "Cerca de pautes obertes de lectura (ORFs)".
o 2 15. Quin és el %G+C del ORF de la pregunta anterior? Nota: Pots utilitzar l'eina següentper fer el càlcul.
o 61,67 16. Quin és el pes molecular (MW) en Da d'aquesta proteïna? MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFF YTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSI CSLYQLENYCN o 11980,91 17. Escriu el codi d'una proteïna que tingui pI = 5.23 i el Pes Molecular sigui 26686 Daltons.
o A0A323 18. Quines de les proteases següents tallen a la proteïna ALBU_HUMAN (P02768)? o Proteinase K o Trypsin 19. Quin és el tamany del genoma de Acaryochloris marina? o 6503724 nt 20. Quina de les següents revistes publiquen articles sobre bioinformàtica? o Bioinformatics o In Silico Biology o BMC Bioinformatics o Briefings in Bioinformatics ...