Projecte final 1AJX (BIA) (Part genètica) (2017)

Trabajo Catalán
Universidad Universidad de Girona (UdG)
Grado Biología - 3º curso
Asignatura Bioinformàtica Aplicada
Año del apunte 2017
Páginas 13
Fecha de subida 01/07/2017
Descargas 0
Subido por

Descripción

Inclou el projecte final corresponent a la part genètica de l'assignatura de Bioinformàtica Aplicada (BIA) proteïna 1AJX

Vista previa del texto

Universitat de Girona Projecte Bioinformàtica Aplicada Natalia Mingorance García [HIV-1 REVERSE TRANSCRIPTASE] Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA Aquest document conté la informació corresponent al gen HIV-1 Reverse Transcriptase, amb codi identificador de GenBank GQ303996 i codi de Protein Data Bank 1AJX (centrant l’atenció en la cadena B en determinats apartats).
La primera part del document correspon a l’anàlisi del gen d’estudi a nivell d’estructura gènica, cerca de seqüències homòlogues, alineament múltiple d’aquestes seqüències, anàlisi filogenètic i descripció biològica del gen mitjançant termes GO.
La segona part del document correspon a la visualització i anàlisi de l’estructura tridimensional de la proteasa del VIH-1 en complex amb l’inhibidor cíclic de la urea AHA001, estudi de docking de la llibreria de lligands anàlegs del lligand nadiu sobre el centre actiu i anàlisi del mode d’enllaç d’aquests. També inclou l’anàlisi corresponent a la modificació de la proteïna mitjançant la mutació d’un aminoàcid clau del centre actiu i la simulació de dinàmica molecular de la proteïna mutada, així com la comparació de les interaccions presents entre els lligands i la proteïna abans i després de la mutació.
1 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA PART 1: HIV-1 REVERSE TRANSCRIPTASE 1- Descripció de l’estructura gen. Llargària de nucleòtids, i aminoàcids si codifica per proteïnes. Nombre d’exons, introns, etc.
L’anotació de la seqüència estudiada és “HIV-1 isolate BCCFE_HOMER_HIV_RTEND_1392 from Canada reverse transcriptase (pol) gene, partial cds”.1 La seva seqüència nucleotídica és la següent: >GQ303996.1 HIV-1 isolate BCCFE_HOMER_HIV_RTEND_1392 from Canada reverse transcriptase (pol) gene, partial cds TGGTGGACAGAGTATTGGCAAGCCACCTGGATTCCTGAGTGGGAGTTTRTCAATA CCCCTCCCTTAGTRAAATTATGGTACCAGTTAGAGAAAGAACCCATAGTAGGAGC AGAAACTTTCTATGTAGATGGGGCAGCCAATAGGGAAACTAAATTAGGAAAAGCA GGATATGTTACTGACAGAGGAAGACAAAARGTTGTCCCTCTAACAGACACAACAA ATCAGAARACTGAGTTACAAGCAATTTATCTAGCTTTGCAGGATTCAGGATTAGAA GTAAACATAGTAACAGACTCACAATATGCATTAGGAATAATTCAAGCACAACCAGA TAAGAGTGAGTCAGARTTAGTCAGTCAAATAATAGAGCAGTTAATAAAAAAGGAAA AGGTCTACCTAGCATGGGTACCAGCACACAAAGGAATTGGAGGAAATGAACAAGT AGATAAATTAGTCAGTGCTGGAATCAGGAAAGTACTA Tot i que s’han descrit dos tipus antigènics de VIH per l’espècie humana2, el gen que s’estudia en aquest informe correspon al virus 1 de la immunodeficiència humana (VIH-1), el qual prové del gènere Lentivirus i és el causant de la síndrome d'immunodeficiència adquirida (SIDA).3 La replicació del VIH-1 implica el pas de ARN monocatenari4 a ADN bicatenari mitjançant l’enzim transcriptasa inversa i la posterior integració de l'ADN a la cromatina humana.5 Aquest gen consisteix en una molècula d’ADN lineal amb una llargària nucleotídica de 480 parells de bases i correspon a un partial CDS, és a dir, tota la seqüència és codificant. No hi ha cap intró i tota la seqüència correspon a un únic exó, el qual consta exactament de 160 aminoàcids6 (és a dir, codifica per proteïnes) i el producte resultant de la seva traducció és el següent: WWTEYWQATWIPEWEFXNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAG YVTDRGRQKVVPLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSES ELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL.
2- Cerca a les bases de dades biològiques de com a mínim 5 seqüències homòlogues del gen en qüestió (Caldrà indicar els nombres d’accés de GenBank de les seqüències utilitzades).
Per trobar seqüències homòlogues es realitza un BLAST7 (eina bàsica de recerca d’alineament local que pertany al portal de NCBI) de nucleòtids carregant la seqüència en format FASTA.
Les 5 seqüències homòlogues escollides pel gen HIV-1 Reverse Transcriptase s’han seleccionat sense centrar l’atenció en els percentatges de Query ni els d’identitat. El 2 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA motiu pel qual s’ha realitzat d’aquesta manera és que aquests percentatges són elevats en totes les seqüències trobades i s’ha focalitzat l’interès en trobar possibles diferències entre seqüències allunyades geogràficament. Així doncs, s’ha optat per una seqüència amb origen a Canadà (per tal de comprovar si tot i estar a la mateixa regió existeixen variacions) i altres quatre corresponents a diferents localitzacions allunyades entre sí:      HIV-1 isolate BCCFE_HOMER_HIV_RTEND_1484 from Canada reverse transcriptase (pol) gene, partial cds (GQ303976.1)8 HIV-1 isolate 6499 from Netherlands pol protein (pol) gene, partial cds (GU301081.1)9 HIV-1 isolate 92KYS10 from South Korea pol protein (pol) gene, partial cds (HQ026548.2)10 HIV-1 isolate 09CNgx0051 from China pol protein (pol) and vif protein (vif) genes, partial cds (JQ028396.1)11 HIV-1 isolate M7507TOB8U from USA pol protein (pol) gene, partial cds (GQ372016.1)12 3- Alineament múltiple de les diferents seqüències. En aquest apartat s’haurà d’incloure la longitud de l’alineament múltiple, la seqüència consens, el nombre de posicions variables i una matriu de distància.
La longitud de l’alineament múltiple és de 480 pb, ja que s’alinea la seqüència d’interès amb les 5 seqüències escollides anteriorment i, per tant, la longitud màxima d’aquest alineament múltiple serà igual a la longitud de la seqüència que es vol estudiar. Per realitzar l’alineament múltiple s’utilitza el programa BioEdit13, concretament l’aplicació accessòria ClustalW Multiple Alignment.
La seqüència consens obtinguda és la següent: TGGTGGACAGAGTATTGGCARGCCACYTGGATTCCTGAGTGGGAGTTTGTCAATA CCCCTCCCTTAGTGAARTTATGGTACCARTTAGARAAAGAACCCATARYAGGAGC AGAAACTTTCTATGTAGATGGRGCAGCYAATAGGGARACTAAATYAGGAAAAGCA GGATATGTWACTGACARAGGAAGASAAAARGYTRTYYCYCTAACDGACACAACAA ATCAGAAGACTGAGTTACAAGCAATTYATCTAGCWTTGCAGGATTCRGGATTAGA AGTAAACATAGTRACAGACTCACAATATGCATTRGGRATMATTCAAGCACAACCAG ATAARAGTGARTCAGARTTAGTCAGYCAAATMATAGAGSAGTTAATAAAAAAGGAA AARGTCTACCTRGCATGGGTACCAGCACACAAAGGAATTGGAGGAAATGAACAAG TAGAYAAATTRGTCAGTGCTGGAATCAGGAAAGTACTA Les sis seqüències són similars, ja que el nombre de posicions variables és 38 respecte les 480 de l’alineament realitzat.
Per realitzar la matriu de distàncies (Pairwise Distances) mitjançant el programa MEGA614 s’empra la següent configuració dels paràmetres: Variance Estimation Method: Analytical method; Substitutions Type: Nucleotide; Model: p-distance; Substitutions to Include: d: Transitions + Transversions i Gaps/Missing data Treatment: Pairwise deletion. La matriu de distàncies resultant es mostra a continuació (Taula 1): 3 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA Taula 1. Matriu de distància obtinguda mitjançant MEGA6 per les seqüències de l’AMS. Per sota de la diagonal es representen els càlculs de distància entre seqüències i per sobre de la diagonal les variàncies.
MATRIU DE DISTÀNCIA Mostra China Canada Netherlands South Korea Mostra 0.008 0.007 0.007 0.008 China 0.029 0.008 0.008 0.008 Canada 0.026 0.030 0.007 0.007 Netherlands 0.024 0.034 0.022 0.008 South Korea 0.029 0.031 0.026 0.028 USA 0.027 0.027 0.024 0.030 0.027 USA 0.008 0.007 0.007 0.008 0.007 Al tractar-se de matrius de distància, les seqüències més semblants seran aquelles que presentin un valor més baix calculat. D’aquesta manera, les seqüències més semblants són les corresponents a Canadà i els Països Baixos (Netherlands) amb un valor de 0.022. D’altra banda, les seqüències menys semblants són les corresponents a Xina i Països Baixos amb un valor de 0.034.
4- Anàlisi filogenètic. Reconstrucció filogenètica de l’alineament múltiple mitjançant com a mínim 2 mètodes.
A partir de l’alineament múltiple de les seqüències descrites anteriorment s’ha realitzat l’anàlisi filogenètic per tal d’analitzar les relacions de parentesc entre aquestes. Per ferho, s’han efectuat diferents reconstruccions filogenètiques (mitjançant MEGA6) basades principalment en tres mètodes: Neighbor-Joining (NJ), Maximum Parsimony (MP) i Maximum Likelihood (ML).
o Mètode de Neighbor-Joining Per realitzar la reconstrucció filogenètica de l’alineament múltiple, aquest mètode es basa en distàncies evolutives. El principi d’aquest mètode és trobar parells d’unitats taxonòmiques operacionals (OTUs) que minimitzin la longitud total de la branca en cada etapa d’agrupació d’OTUs tot obtenint un arbre sense arrel.15 Per l’elaboració de l’arbre mitjançant el mètode Neighbor-Joining es va utilitzar la configuració següent pels paràmetres del programa MEGA6: Test of Phylogeny: Bootstrap method; No. Of Bootstrap Replications: 1000; Substitutions Type: Nucleotide; Model: p-distance; Substitutions to Include: d: Transitions + Transversions i Gaps/Missing data Treatment: Pairwise deletion. L’arbre obtingut es mostra a continuació (Figura 1): Figura 1. Arbre filogenètic obtingut mitjançant el mètode de Neighbor-Joining.
4 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA o Mètode de Maximum Parsimony Per realitzar la reconstrucció filogenètica de l’alineament múltiple, aquest mètode utilitza per una determinada topologia (patró de ramificació d’un arbre), la suma del nombre mínim de possibles substitucions nucleotídiques. En conseqüència, genera el que es coneix com arbre de longitud (normalment sense arrel) i la topologia d’un l’arbre de longitud mínima es coneix com arbre de màxima parsimònia.16 Per l’elaboració de l’arbre mitjançant el mètode Maximum Parsimony es va utilitzar la configuració següent pels paràmetres del programa MEGA6: Test of Phylogeny: Bootstrap method; No. Of Bootstrap Replications: 1000; Substitutions Type: Nucleotide i Gaps/Missing data Treatment: Complete deletion. Els arbres obtinguts es mostren a continuació (Figura 2-3): Figura 2. Arbre filogenètic (I) obtingut mitjançant el mètode de Maximum Parsimony.
Figura 3. Arbre filogenètic (II) obtingut mitjançant el mètode de Maximum Parsimony.
o Mètode de Maximum Likelihood Per realitzar la reconstrucció filogenètica de l’alineament múltiple, aquest mètode parteix d’un arbre inicial que es construeix utilitzant un mètode ràpid però subòptim (com Neighbor-Joining). Les longituds de les seves branques s’ajusten per maximitzar la probabilitat d’agrupar el conjunt de dades, les quals corresponen a la topologia de l’arbre sota el model evolutiu emprat. Aquestes longituds es calculen per les diverses topologies i la que obté una major probabilitat és la més bona, on la cerca continua fins que no es troben probabilitats superiors.14 Per l’elaboració de l’arbre mitjançant el mètode Maximum Likelihood es va utilitzar la configuració següent pels paràmetres del programa MEGA6: Test of Phylogeny: Bootstrap method; No. Of Bootstrap Replications: 1000; Substitutions Type: Nucleotide; Model/Method: Jukes-Cantor model; Gaps/Missing data Treatment: Complete deletion i Branch Swap Filter: none; L’arbre obtingut es mostra a continuació (Figura 4): 5 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA Figura 4. Arbre filogenètic obtingut mitjançant el mètode de Maximum Likelihood.
Finalment, els resultats obtinguts per les reconstruccions filogenètiques (Figures 1-4) s’ajusten bastant bé pel que fa als obtinguts mitjançant la matriu de distàncies (Taula 1). D’aquesta manera, novament es confirma que les seqüències més semblants són les corresponents a Canadà i Països Baixos (Figures 2-4) i les menys semblants són les seqüències corresponents a Xina i Països Baixos (Figura 4).
L’arbre obtingut al primer mètode (NJ) (Figura 1) no concorda amb la resta d’arbres basats en altres mètodes (Figures 2-4). Es considera que això s’explica pel simple fet que cada mètode es basa en uns principis diferents i, per tant, és normal que hi hagi diferències entre ells.
En quant als arbres obtinguts amb el mètode de MP (Figures 2-3), el que més coincidències té amb l’obtingut mitjançant el mètode de ML (Figura 4) és el primer (Figura 2). Per tant, es considera que tots dos arbres són els més indicats per la representació d’aquesta filogènia.
Pel que fa a la robustesa dels resultats, s’utilitza el Bootstrap. Aquest, consisteix en generar pseudo-mostres de seqüències reemplaçant les posicions nucleotídiques a l’atzar respecte la mostra original i serveix per veure la confiança dels arbres obtinguts, concretament dels nodes que pertanyen a l’agrupació de les seqüències, tot indicant la probabilitat de que es generés aquesta agrupació si el procediment es realitzés a l’atzar. La robustesa és elevada, doncs, quan aquests valors s’apropen a 100.17 Tal i com s’ha indicat anteriorment, s’ha aplicat un valor de Bootstrap de 1000 per construir els arbres filogenètics. En aquest cas, la robustesa de les dades és elevada per les seqüències més semblants (amb valors de Bootstrap de 69 per MP i 63 per ML) però baixa en la resta d’agrupacions, la qual cosa apunta a que les dades no semblen tenir una relació evolutiva intensa i, per tant, no es pot definir amb seguretat el seu parentesc.
5- Descripció biològica del gen mitjançant termes GO (Gene Onthology).
El projecte Gene Ontology (GO) és un consorci creat per fer front a la necessitat de descripcions consistents de productes gènics a mitjançant bases de dades (és a dir, la necessitat d’estandardització del vocabulari).18 Per assolir els seus objectius, el projecte GO ha desenvolupat tres ontologies estructurals que descriuen els productes gènics basant-se en els seus processos biològics associats, en components cel·lulars i en funcions moleculars en una espècie de forma independent. D’aquesta manera, el primer consisteix en el desenvolupament 6 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA i manteniment de les pròpies ontologies; el segon, en l'anotació dels productes gènics, la qual cosa implica fer associacions entre les ontologies i els gens i productes de gens en les bases de dades col·laboradores; i en tercer lloc, en el desenvolupament d'eines que faciliten la creació, manteniment i ús d'ontologies.
Per realitzar la cerca dels termes GO s’ha utilitzat la plataforma QuickGO 19 que pertany al portal EMBL-EBI. D’aquesta manera, el número d’accés d’UniProtKB corresponent al gen d’estudi és C8BYC2. Dins d’aquest, s’han trobat diferents termes GO que es classifiquen, en aquest cas, en dos grups (ja que pel tercer grup de la classificació no s’han trobat termes GO) que es mostren més endavant.
Tenint en compte que l’activitat del gen d’estudi (HIV-1 Reverse Transcriptase) implica, tal i com s’ha esmentat anteriorment, el pas de ARN monocatenari a ADN bicatenari, els termes GO associats als processos biològics i funcions moleculars trobats per aquest gen expliquen perfectament la funció que realitza aquest gen: per una banda, per tal de poder realitzar la seva funció, la transcriptasa inversa depèn del RNA per sintetitzar la primera cadena de cDNA (Figura 5) i és necessària la hidròlisi de l'enllaç fosfodièster de la cadena d’ARN (Figura 6) per sintetitzar la segona cadena de cDNA.
D’altra banda, es realitzen unions d’àcid nucleic al llarg de tot el procediment (Figura 7), intervé la polimerasa d’ADN dirigida per ARN (Figura 8) a l’hora de sintetitzar la segona cadena de cDNA a partir de la primera i és necessària l’activitat ribonucleasa d’híbrids ARN:ADN (Figura 9) en el moment d’eliminar la cadena d’ARN i sintetitzar la primera cadena de cDNA. Així doncs, els termes GO trobats són els següents: o Termes GO associats a processos biològics  Procés biosintètic de DNA dependent de RNA (GO: 0006278).
7 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA Figura 5. Esquema representatiu del terme GO 0006278.
 Hidròlisi de l'enllaç fosfodièster d’ARN, endonucleolítica (GO:0090502).
Figura 6. Esquema representatiu del terme GO 0090502.
o Termes GO associats a funcions moleculars  Unió d’àcid nucleic (GO:0003676).
8 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA Figura 7. Esquema representatiu del terme GO 0003676.
 Activitat de la polimerasa d’ADN dirigida per ARN (GO:0003964).
Figura 8. Esquema representatiu del terme GO 0003964.
 Activitat ribonucleasa d’híbrids ARN:ADN (GO:0004523).
9 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA Figura 9. Esquema representatiu del terme GO 0004523.
Bibliografia 1: Nucleotide [Internet]. Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information; [1988] – . Accession No. GQ303996.1, HIV-1 isolate BCCFE_HOMER_HIV_RTEND_1392 from Canada reverse transcriptase (pol) gene, partial cds; [citat 2017/05/19].
Disponible des de: https://www.ncbi.nlm.nih.gov/nuccore/GQ303996 2: Fauci AS, Desrosiers RC. Pathogenesis of HIV and SIV. In: Coffin JM, Hughes SH, Varmus HE, editors. Retroviruses. Cold Spring Harbor (NY): Cold Spring Harbor Laboratory Press; 1997.
Available from: https://www.ncbi.nlm.nih.gov/books/NBK19359/ 3: Cloyd MW. Human Retroviruses. In: Baron S, editor. Medical Microbiology. 4th edition. Galveston (TX): University of Texas Medical Branch at Galveston; 1996.
Chapter 62. Available from: https://www.ncbi.nlm.nih.gov/books/NBK7934/ 4: Wu, Y. (2004). HIV-1 gene expression: lessons from provirus and non-integrated DNA. Retrovirology, 1, 13. http://doi.org/10.1186/1742-4690-1-13 5: Watts, J. M., Dang, K. K., Gorelick, R. J., Leonard, C. W., Bess, J. W., Swanstrom, R., Burch, C. L., Weeks, K. M. (2009). Architecture and Secondary Structure of an Entire HIV-1 RNA Genome.
Nature, 460(7256), 711–716.
http://doi.org/10.1038/nature08237 10 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA 6: Protein [Internet]. Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information; [1988] – . Accession No. ACU46301.1, reverse transcriptase, partial [Human immunodeficiency virus 1]; [citat 2017/05/19].
Disponible des de: https://www.ncbi.nlm.nih.gov/protein/255984458 7: Altschul, S.F., Gish, W., Miller, W., Myers, E.W. & Lipman, D.J. (1990) "Basic local alignment search tool." J. Mol. Biol. 215:403-410. PubMed 8: Nucleotide [Internet]. Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information; [1988] – . Accession No. GQ303976.1, HIV-1 isolate BCCFE_HOMER_HIV_RTEND_1484 from Canada reverse transcriptase (pol) gene, partial cds; [citat 2017/05/19]. Disponible des de: https://www.ncbi.nlm.nih.gov/nuccore/GQ303976 9: Nucleotide [Internet]. Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information; [1988] – . Accession No. GU301081.1, HIV-1 isolate 6499 from Netherlands pol protein (pol) gene, partial cds; [citat 2017/05/19].
Disponible des de: https://www.ncbi.nlm.nih.gov/nuccore/GU301081.1 10: Nucleotide [Internet]. Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information; [1988] – . Accession No. HQ026548.2, HIV-1 isolate 92KYS10 from South Korea pol protein (pol) gene, partial cds; [citat 2017/05/19]. Disponible des de: https://www.ncbi.nlm.nih.gov/nuccore/HQ026548.2 11: Nucleotide [Internet]. Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information; [1988] – . Accession No. JQ028396.1, HIV-1 isolate 09CNgx0051 from China pol protein (pol) and vif protein (vif) genes, partial cds; [citat 2017/05/19].
Disponible des de: https://www.ncbi.nlm.nih.gov/nuccore/JQ028396.1 12: Nucleotide [Internet]. Bethesda (MD): National Library of Medicine (US), National Center for Biotechnology Information; [1988] – . Accession No. GQ372016.1, HIV-1 isolate M7507TOB8U from USA pol protein (pol) gene, partial cds; [citat 2017/05/19].
Disponible des de: https://www.ncbi.nlm.nih.gov/nuccore/GQ372016.1 13: Hall, T.A. (1999). BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl. Acids. Symp. Ser. 41:95-98.
14: Tamura, K., Stecher, G., Peterson, D., Filipski, A., & Kumar, S. (2013). MEGA6: Molecular evolutionary genetics analysis version 6.0. Molecular Biology and Evolution, 30(12), 2725-2729. doi: 10.1093/molbev/mst197 15: Saitou, N. & Nei, M. (1987) The neighbor-joining method: A new method for reconstructing phylogenetic trees. Molecular Biology and Evolution 4:406-425.
16: Kannan, L., & Wheeler, W. C. (2012). Maximum Parsimony on Phylogenetic networks. Algorithms for Molecular Biology : AMB, 7, 9.
http://doi.org/10.1186/1748-7188-7-9 11 Natalia Mingorance García 3r Biologia – UdG UNYBOOK: nattymg23 BIOINFORMÀTICA APLICADA 17: Efron, B., Halloran, E., & Holmes, S. (1996). Bootstrap confidence levels for phylogenetic trees. Proceedings of the National Academy of Sciences of the United States of America, 93(23), 13429.
18: The Gene Ontology Consortium. (2015). Gene Ontology Consortium: going forward. Nucleic Acids Research, 43(Database issue), D1049–D1056.
http://doi.org/10.1093/nar/gku1179 19: Binns, D., Dimmer, E., Huntley, R., Barrell, D., O’Donovan, C., & Apweiler, R.
(2009).
QuickGO: a web-based tool for Gene Ontology searching. Bioinformatics, 25(22), 3045–3046.
http://doi.org/10.1093/bioinformatics/btp536 12 ...

Tags:
Comprar Previsualizar