Qüestionari tema 4 (Nota: 10) (2015)

Ejercicio Catalán
Universidad Universidad Rovira y Virgili (URV)
Grado Biotecnología - 2º curso
Asignatura Bioinformática
Año del apunte 2015
Páginas 5
Fecha de subida 29/04/2016
Descargas 39
Subido por

Vista previa del texto

Preguntes Tema 4 1. Quina de les següents parelles de gens són gens ortòlegs? a. El gen humà de l'hemoglobina alfa i el gen de la vaca de l'hemoglobina alfa 2. Quina de les següents parelles de gens són gens paràlegs? a. El gen humà de l'hemoglobina alfa i el gen humà de l'hemoglobina beta 3. Segons la matriu de substitució PAM250, en quina proporció respecte el que s'esperaria per atzar en funció de la freqüència d'utilització de cada aminoàcid es dóna la substitució I <-> V? a. 2,51 4. Segons la matriu de substitució PAM250, quina de les següents substitucions és més probable? a.
H↔R 5. Segons la matriu de substitució BLOSUM62, quina de les següents substitucions és més probable? a. W↔F 6. Fes un Dot Plot de les seqüències del Swiss-Prot amb codis P02866 i P08902. Quina interpretació en fas? És possible alinear completament les dues seqüències (prova a fer un alineament global i un de parcial)? a. L'extrem Nterminal d'una de les seqüències és homòloga a l'extrem Cterminal de l'altre; i l'extrem Cterm de la primera ho és de l'extrem Nterm de la segona 7. Després de fer un DotPlot d'una seqüència vs ella mateixa, has obtingut el resultat que es mostra. Quina interpretació en fas? a. La seqüència conté una sèrie de repeticions o tandem repeats 8. Després de fer un DotPlot d'una seqüència vs ella mateixa, has obtingut el resultat que es mostra. Quina interpretació en fas? a. La seqüència conté una zona de baixa complexitat (low-complexity region) 9. Compara les següents seqüències de DNA. Una correspon a un gen i l'altre a la seqüència del seu mRNA. Fes un DotPlot i un alineament global. A partir d'aquestes comparacions, quans introns et sembla que té aquest gen? (Seqüència molt llarga) a. 2 10. A partir de l'alineament global anterior entre el mRNA i la seqüència del gen, escriu els deu darrers nucleòtids del primer intró. Nota: Per evitar que apareguin gaps no contigus, pots pujar més la penalització d'obertura dels gaps (Gap open), mantenint la penalització per estendre un gap (Gap extend) a. TCCACGCCAG 11. Utilitza el següent servidor per a calcular el % de similitud entre les dues seqüències següents utilitzant la matriu BLOSUM40, Open gap penalty 10.0 i Gap extension penalty 0.5 (Seqüència llarga) a. 90,7 12. Fes un alineament local utilitzant el valors per defecte del programa EMBOSS Water entre aquestes dues seqüències.
>seq1 AIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRN KCQYCRFQKCLAVGMSHNAIRF >seq2 MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGF FRRSQR CNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQR DSLHAEVQK QLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACP PGLLKAS GSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRF EEHRHPG LGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLR QRSNIF SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIV LLKAGAMEV VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSE DEIALY TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKL RSLCSQHV ERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK Entre quins aminoàcids de la segona seqüència trobes similitud amb la primera seqüència? a.
Entre els aminoàcids 29 i 103 13. Escull l'alineament que correspon al següent diagrama de l'algoritme NeedlemanWunsch 1: _SV__ETD TSINQET_ 2: _SVETD_ TSINQET 3: SV___ETD TSINQET_ 4: _S__VETD TSINQET_ a. 1 14. Fes un blastp de la seqüència següent (Seqüència llarga) a. endo-1,4-beta-xylanase 15. What is BLAST? a. A very fast program for searching sequence databases.
16. A frequent use of nucleotide-nucleotide BLAST is to check oligonucleotides for hybridization or PCR. The goal most people have when doing this is to make sure that the primer will give a unique product from the target genome or cDNA population.
Because BLAST is local and searches both strands, one can simply concatenate a pair of +/- strand primers and use them in a single search. Combine the following pair of candidate PCR primers in a nucleotide-nucleotide search against the "Human genomic + transcript" nucleotide database and identify the gene amplified.
F12 GTCAAGTGGCAACTCCGTCAG R8 TTGAGAGATGGATTGTTGC a. Homo sapiens tumor necrosis factor (ligand) superfamily, member 10 (TNFSF10) 17. As the database grows, so does the number of chance occurrences of amino acid motifs that spell out words or people's names in single-letter amino acid codes. One such name motif is ELVIS. Find the number of occurrences of ELVIS in the protein nr and among human proteins.
Et sembla que els resultats que trobes són significatius o fruit de l'atzar, Per què? a. Són fruit de l'atzar com es pot comprovar amb els valors elevats d'E-value que surten 18. What is the meaning of an E-value in a BLAST analysis? a. The number of times you may expect a chance match with a score at least as good as the one under consideration.
19. Fes un blastp de la proteïna RecA d'E. coli (P0A7G6) contra tots les proteïnes humanes al servidor blast del ncbi. Quin d'aquestes seqüències trobes amb un E-value <0.01? a. NP_008999.2 20. Després de clonar un gen humà en el bacteri Escherichia coli, has obtingut la seqüència parcial de l'insert següent >embl|N85333|N85333 J3230F Human fetal heart gcgccatctttggtatttagcgcctgggtgaggcccggcgctttggtgtccggcgcaaca atctggctggcgttggcgtgatcagcggtgactatgaccagcgtgttgccatccttttta gcgaattccagcgcccgttgtacgcttcgtcgagatcgaccgtctcgccaatttgcccac aagggttcgcagcgtgatcctgtttatcgattgatgcaccttcaacttgcagggaaaagc ctttctcatttttactcaacaattcaatggctttatcagtcatctgcgccagggtcggga cgtttcattacgttcgggttagggacaggaaatccgggttt Per saber la funció del gen clonat, fes un blast. A quina conclusió arribes? a. Es tracta d'una contaminació del gen de la fosfatasa alcalina d'E. coli ...

Comprar Previsualizar